SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002409634.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002409634.1.51680
Domain Number 1 Region: 488-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family Laminin-type module 0.00055
Further Details:      
 
Domain Number 2 Region: 593-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000781
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 3 Region: 103-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 4 Region: 550-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family Laminin-type module 0.002
Further Details:      
 
Domain Number 5 Region: 56-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.009
Further Details:      
 
Domain Number 6 Region: 383-531
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000251
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 7 Region: 641-687
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000053
Family Laminin-type module 0.026
Further Details:      
 
Weak hits

Sequence:  XP_002409634.1.51680
Domain Number - Region: 990-1096
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000732
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002409634.1.51680
Sequence length 1278
Comment laminin gamma-1 chain, putative, partial [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
CNCNGRSRKCYFDKELYDRTGHGGHCINCSDNTDGPNCERCRENFYQRSDGRCVACGCDP
LGSRVLQCNSKGQCPCKPGVEGQRCDRCAPNFYDFSEQGCRPCGCSMAGSVDSPPSCDAA
TGVCRCKANVEGRQCDRCRPGFFNLQRDNEFGCTPCFCFGHSAVCQSAPGYSKHTVYSTF
TRDKEHWKAVDSRGARVPTRHEYAAHHLAVAAPGENQVYFVAPERFLGDQRGSYNQNLTF
TLRIGEEGARSSLEDVVLESPSQSVSQHIFGQGNPLPSIRNQDYRFRLHQDSRYGWSPTL
SAHEFMALLANLTAIKIRATYLPRGESTLHRLVCGGKKGVGGLPGIGQGILIPPDKFCDP
SEYTTSSCRATLQHHTFRVSNRYGCPRQTNPRHWCSSLGHCICQHNTAGEFCERCAPRFY
GNALVGSPEDCQPCPCPDQGACAVLPDESVVCLECPQGYSGGRCDLCFDGHFGDPQGRYG
AERPCQKCDCNDNVDPNAVANCNTTTGECLKCIYKTAGFHCEKCLPGHYGDALAVPKGDC
KRNMQLLSLGSTSDQCDPVTGQCPCRPNVAGRECGQCREGTWNLEGGQGCEQCGCHLVGS
VNRTCDQRTGQCHCRPGVGGKRCDQCLPYHYGFSPDGCLPCDCDSLGSVSLQCAPDGQCE
CRPNVEGRRCERCKENKYNREAGCVDCPTCYNLVQDAVNQHRDKVADLARLLDNIEKNPQ
IVKSVDFEKKLEEVMVIVNDLWKDAKQASGTDKSLADRLEELVRRMHRVQETASKVGQET
WLAEEALWAAQSNLSQAEASVERMGTTLAQAHRFLEDEGQHALRRALERSHRFGQQSEMM
SQIARDARQLADRMKDIMDLMLRTKKMAEEAKAEVVKAYEDALRVYSDTTSVQMPDIDTD
DLLHQAQEIIEEVRQPLGRAISSLYDCAIEQQNHSQCCEKEPRSGQKGSKPQRSFTFKMQ
AQRIYKEADDLMEKHKNIFDKVKPQKDEAEDLLAEAQRQQQVTDELLADTDAAYAKAKEA
VQSGEKILEEAQNTLKTLKEFDENVKNSKEKARAALERVPEIRALIEEAENKTADARDAL
KDAEEDANAASDIATQAERIAEQASKVRHERLAKTMAATTLTSRACRKGGRRAYKLQAAT
EDHFAVYRPKRHNKISCNLRFKFSKDATSLKLRGNMKSADLRRWGERLSPVPVAANVDEV
DPGRLDELERRLAEAERELERARLAERLAELQKAREQQVLWMRDYEDEINQLKKDVANVR
LISEALPDKCYRRIRLEP
Download sequence
Identical sequences B7Q1H6
6945.ISCW009943-PA XP_002409634.1.51680 ISCW009943-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]