SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002409644.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002409644.1.51680
Domain Number 1 Region: 16-156
Classification Level Classification E-value
Superfamily Fibronectin type III 2.23e-19
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002409644.1.51680
Sequence length 220
Comment hypothetical protein IscW_ISCW017418 [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
MPTYVTLCPLQPPRKDLHHGKVQGYYIGYKEVEKEEAEFQYKNVEALDVTSGARLHQMSH
LTNLKRKTSYVVKVQAYNSEGAGPMSDDVRATTLEADYVLHYQVKGGDWQQKALSTNSNK
YTVEGLKCGSVYSLYMTATNSLGTAEPRDIIYARTKGADDPLSKCRGSVDNMGMAEFCAM
KQRLQQQQLRHKEEEAYSKGTSFYASPARKPVPVSSDPRM
Download sequence
Identical sequences B7PCC6
6945.ISCW017418-PA ISCW017418-PA XP_002409644.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]