SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002411893.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002411893.1.51680
Domain Number 1 Region: 667-954
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-78
Family Protein kinases, catalytic subunit 0.00000000386
Further Details:      
 
Domain Number 2 Region: 299-480
Classification Level Classification E-value
Superfamily L domain-like 2.3e-42
Family L domain 0.00016
Further Details:      
 
Domain Number 3 Region: 22-185
Classification Level Classification E-value
Superfamily L domain-like 8.79e-36
Family L domain 0.0002
Further Details:      
 
Domain Number 4 Region: 466-568
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.07e-19
Family Growth factor receptor domain 0.0000787
Further Details:      
 
Domain Number 5 Region: 160-309
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.11e-18
Family Growth factor receptor domain 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002411893.1.51680
Sequence length 982
Comment epidermal growth factor receptor, putative, partial [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
SRPVCIGTNGRMSVPSNREHHYQNLRDRYTNCTYVDGNLELTWLQNKSLDLSFLRDIREV
TGYVLISHVDVQRILLPSLMIVRGRNLFKLNVHDEEFALIVTLSKMDNLELPALRDILRG
NVGFFNNYNLCHVRGVQWDEILSGPPAHMVYVYNFTQPERTCPPCDASCRGGHCWGEGPH
NCQKFSKVNCSPQCHQGRCFGPEPRECCHLFCAGGCVGPKQSDCLACQNFYDDGVCKQEC
PPMMRYNPNTYSWEDNPDGKYAYGATCVRDCPEHLLRDSGACVRNCPPNKKAQHGECVPC
DGPCPKNCQGVNIVNSINIELFRGCTIIEGSLTILDSTFSFGPRYEEMDPSKLEVFSTLK
EVTGYVNIQASHPNFTSLSYFRNLEVIGGRTLTEYFAALYIVKSSLKSLNLRSLNKIRSG
SVAILENKDLCFADSVDWYQVMKSSAHNILLQRNANRTDCEAQNLVCHSQCSTSGCWGPA
PNECLSCKSYRLEDTCIEKCDTSKGIYDNGNYVCKHCHEECLGECYGPGANNCTQCRHVR
DGPYCVRECPDTKYNQSGECMPCHENCIGGVVCLFSFLCELAVTPENFLSRFREEDHLPA
ILASAGGCILLLGVFLAVFSYHWVQRAKTKENTMKMTMRMSGFEDNEPLKPTDIKPNLAQ
LRIVKEAELRKGGILGYGAFGTVYKGVWVPEGENVRIPVAIKVLREGTAPNTNKEFLEEA
YIMASVDHPNVLKLLAVCLTSQLMLVTQLMPLGCLLDYVRNNKDKIGSKPLLNWCTQIAR
GMAYLEEKRMVHRDLALRNVLLQTPGCVKITDFGLAKLLDNNEFEYKAAGGKMPIKWLAL
ECIQHRIFTHKSDVWAFGVTVWELLTYGMRPYENVSARDVPDLLEKGERLNQPSICTIDV
YMIMIKCWMLDAGSRPSFKELAEEFAKMARDPGRYLVVSGDKLMRLPSYTPQDEKELIRN
LSMPMEGPEVIMDAEEYLQPTR
Download sequence
Identical sequences B7Q655
XP_002411893.1.51680 ISCW021718-PA 6945.ISCW021718-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]