SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002413028.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002413028.1.51680
Domain Number - Region: 14-138,174-190
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0103
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002413028.1.51680
Sequence length 221
Comment hypothetical protein IscW_ISCW012545 [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
MPRSSPKERLKRLCKWRYIDDEQAAQCQQCVDEYPLPANFEYEDVSNLRNKCLPRPSRKE
LLRKTCDWYFRNQNIEKSACEACVEKSRLDENASYDDEAQVRSICMPRKPPRERVKDACP
RRFKDSEEIEKCRKCADNFMNDPANNEVQTVDVQQLYRRCLAGNNLKARLLQECQQKMPE
PDVANKCKACILRTYQWRVPKHMIREARKRCFIEGFQENES
Download sequence
Identical sequences B7QBW4
6945.ISCW012545-PA ISCW012545-PA XP_002413028.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]