SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002422584.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002422584.1.24195
Domain Number - Region: 15-86
Classification Level Classification E-value
Superfamily Prefoldin 0.0497
Family Prefoldin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002422584.1.24195
Sequence length 121
Comment hypothetical protein Phum_PHUM002190 [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MYIIYLLINLKSNDTEYQINKTYKRSRKKETKSPEEVNMKLKSNNAVIKSHQSILKFVKK
KKTKKEKIKENLSKSRRDADKDIDETATTTGTTTGTTTGTIKDSDFVGGKTKNKKKWFVK
I
Download sequence
Identical sequences E0V8Z0
XP_002422584.1.24195 121224.XP_002422584 vb|PHUM002190-PA|EEB09846.1|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]