SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002422628.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002422628.1.24195
Domain Number 1 Region: 15-119
Classification Level Classification E-value
Superfamily Histone-fold 2.7e-46
Family Nucleosome core histones 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002422628.1.24195
Sequence length 124
Comment histone H2A [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA
EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT
EKKP
Download sequence
Identical sequences E0V934
XP_002422628.1.24195 XP_002430919.1.24195 121224.XP_002430919 vb|PHUM003520-PA|EEB09890.1|histone vb|PHUM504070-PA|EEB18181.1|histone

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]