SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002423824.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002423824.1.24195
Domain Number 1 Region: 35-226
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.12e-31
Family BCR-homology GTPase activation domain (BH-domain) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002423824.1.24195
Sequence length 637
Comment T-cell activation Rho GTPase-activating protein, putative [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MTSWTERMHRRAATFSNVVTSCGHPSVPYPRRLEKVKFGVPIDEVCKNDIPGSLLVLILK
LNKEAPEKKDVFRAPGHQGNMKKLIHFLQAGRLVNMDNFSVYTIASVLKKFLRKLPGGIF
GREGEQELFHVIELENVDEQRNMIHRLIVSLPIHTQRLLVLLFGTFRVIATNSERCQTGM
TSEALGVSVAPSFFQTCVSDGKQARMEDVQRFKVATKIMKFMIDNFGVSNLFGRENYEYY
ARITGRILKVEEDWIYNFRYPPDCFVSPMSQQEESQSTPALIHLPELSGEPCNASMSMIP
KTNLLESYTRLSISLEENGLFKGSSRSSSSSVTISHHMTLEELRAVNRYAESTKSLSYLP
QVHERQTARMRTRSEWFLSPLIAPGQLLYAIDSDPTSIYLLRSSCSRSSADYRLLKMLAK
KGGTGLSASAESIHKRPSIRRNNSRHVHRTSSKRNKENGSTKKHSPSGSFKKSHHHQDKH
EGGGKTLKLLSSDVKQMKMKEETTGAEPLKEGRINANAGRFLKEDNGNGNGNDGVLGTLY
GSQNSMQDAFGNLSHAQDVRLLKMTSLDSKSSNVGQSMYHHHHQKKNSLGGSSFPSDETN
SNSQSCKQMKVDDVKGDEVSDMDVTTYHVNLTYKPRI
Download sequence
Identical sequences E0VCI0
121224.XP_002423824 XP_002423824.1.24195 vb|PHUM087190-PA|EEB11086.1|T-cell

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]