SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002424885.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002424885.1.24195
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-35
Family cAMP-binding domain 0.00000256
Further Details:      
 
Domain Number 2 Region: 119-201
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-19
Family cAMP-binding domain 0.0000622
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002424885.1.24195
Sequence length 206
Comment cAMP-dependent protein kinase type I-beta regulatory subunit, putative [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MAALSKAIVKNVLFAHLDENERSDIFDAMFPVNFLPGETIIQQGDEGDNFYVIDQGEVEV
YVNSELVTTIGEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRK
MYEEFLSRVSILESLDKWERLTVADALEPVSFEDKETIVRQGEPGDDFYIIVDGTALVLQ
NRSEGEEPMEVGRLGPSDYFGKQKNT
Download sequence
Identical sequences E0VFJ1
121224.XP_002424885 XP_002424885.1.24195 vb|PHUM158240-PA|EEB12147.1|cAMP-dependent

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]