SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002425495.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002425495.1.24195
Domain Number 1 Region: 708-829
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000931
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002425495.1.24195
Sequence length 841
Comment Actin-binding protein anillin, putative [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MDPFTQRMLERAKVRRVKLDGHIASNKDKDSSISHSSQGLVNEVSNAHSSKTNIKDEVLD
PTEARKMKLKKLALLYSSNSNTEEKENYEKISNENVEISCKKPKHRLGRLADLVTKINEW
EDDMSQKSSTQSVKNNKETSNETSTKNPCVLKPPEEKMGFTLSENKYVYEFKDKKKDDVR
DISKNNQNESDNVFKTKPVSTHIRQNQENKSNVKHLNYESSNQLKDPAELSIAERKALFE
KNSGTHLQNFSINFLPEKSKKISKENQIIDKNHQESKFTERSNDNNDVNERLYPNLSEFM
ESNENDVQSETPTYSVTASNENYDDDFITNNIDVNLEGTNTNDSISSNDLSFSKSKECQV
LNKMDKILENALNDVSESDSNMEEMFSSPSSSSINNNLNIMSPSNDNDNGLIHTVSFYRK
QQPKSCPSNVEDTIIVSNPVEDENVLIENKLQALLAEVNKQQIILSQASQALNLCLSSVE
FTGSNEQVESERLLLLASHKRQACLNEIQRLKVEKTLGGTGGNTSEKGDVIMSNISLKLK
RDAIRSMAAESLQYFVCLIKNEERVLATSVVSTTRENLKDFHLQFPGSVKLENLSSDFKV
LVEVYNLELNKQLIDHDTKYHIANKKDKKFLTPIKSKKNESKLVKLRIQSPGGPTAIRST
NFKLCGFMVFSLKEVTRSQWMLNKVPFVSLLEGTLCMTITSKLQINEEFRGFLTMFDDIS
GFGAWHRRWCLLSSHAISFWKYPDDEQKKVPIGTIDLRSIVTENVDVVPHDVCARLHTFL
LESIRPSLAEDKNSLIQTVKDNVTTIRHLLSADSKQEMITWCKKLNKILGLLRNWKCSDE
S
Download sequence
Identical sequences E0VHA1
vb|PHUM204170-PA|EEB12757.1|Actin-binding XP_002425495.1.24195 121224.XP_002425495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]