SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002426579.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002426579.1.24195
Domain Number - Region: 158-197
Classification Level Classification E-value
Superfamily PH domain-like 0.0348
Family Phosphotyrosine-binding domain (PTB) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002426579.1.24195
Sequence length 700
Comment hypothetical protein Phum_PHUM260570 [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MYSFEVTEIGRESVKSVNASMLATLIKDLDKLEFSRKKNKKNGDDEGFESDGNEDDSLSG
DLSNEDAQSTTSSCCMVEDHVFKSLKSEFISRNLFNNNNNKDPTSLVSIIGSIDSANSSG
SSDTDEIEFHSLTPSPVVTQTKKSLQKKFDTIFKSPGDFDKKSTKMEEYPISDVIFCHTE
PKYPNVIAWVIKKNTTSDPGFKSGVGDNFTKIDNCLEVIVVKCKNGDNLKELCSNYLEYS
KRTKLDNYKSIKRKSDAEGKKLINLNPLPPESKDVKVSLSDMKIENSGLIKASELSILNP
KIMTSFKNDIKNSISLNSLIKSDKNLSNKTTIEIKPSSNNNSNVTTASLQSSVTKTQSLV
NISKSWEYETSNSIMKTAGILKEKNYNVGDQFNLVQRTDPNGVTHLEVTKTVEQTKQVPE
KKFANKSKLRKEIEGVIITDVESYCKKEQIRQRYGEKDKKIYDFPPPIRPERKKLGRKKN
QAPSPPTNHHHHHHNLDQKITTGNVKNNFYLSPTTTTTTSPQPPQPQNVVVVVGDNRIKK
EPNLGKSPLIDVKTWQNQNSIRDANNKTGSRGRQQTTTTKHDEKYVDKKRSTSAAGRPTK
KTLMPYRYIYISNDYRESAESIKRCGLQSKIREVGGNLHNSLQNFRRRNSFDDIMSYNNN
NNNNNCNKISNLKSVIKKNKKYCEPKKVTFSAFATVQVVD
Download sequence
Identical sequences E0VKD5
vb|PHUM260570-PA|EEB13841.1|hypothetical XP_002426579.1.24195 121224.XP_002426579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]