SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002427120.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002427120.1.24195
Domain Number 1 Region: 319-615
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.31e-80
Family p120GAP domain-like 0.0000545
Further Details:      
 
Domain Number 2 Region: 140-213
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000685
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 193-294
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000205
Family Synaptotagmin-like (S variant) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002427120.1.24195
Sequence length 1129
Comment conserved hypothetical protein [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MCAYANTYTFRFSLCVYELLIEFFLKEVVSIESVEKNKKCHKARKKTSCRWRRVGLAVLA
TTTRYEYFVIKILERRQDRDGGERHMNPGNEGKTLAREKVAIPPRLRTSRSHESLLSGQS
VMQTMDLGTGGIEIKPLHPSVLGKKHCFQISFPTGNPRYFSCRSADERDKWVHSLRKSVQ
PDQEHMRRKDNSLKISIVEVKGVANKKKYFCELCLDKTLYARTSAKQKGEICFWAENFDF
YQLPQVNLINVNLFREAERKKKRDKNVLIGTVNIPVHEVTSRYYIEKWYPVKTEKGSKEC
PALRIKCRFQSVDILPLHVYQEFLDYICSDYRPLCELLEPVIGVKAKEDISTALVHIMQK
QGLAKEFLSDVVMMDIDRIDDERLMFRGNSLATKAMEAYLKLTGDKYLQETLGGLVTHVL
ANGQDCEVDADKMSNSAALQKQQQNLRSAVEMAWSKIMSSHTYFPTELRECFATFKERLI
EIGREDVSDNLISASIFLRFLCPAILSPNLFNITHEYPNEKAARNLTLIAKTLQTLANFT
RFQGKESFMEFLNDFLEKEALSMKNFLQLISSRVQKENTSHHNITSTDFDGYIDLGKQLS
ILHTLLLECLEKIAPVKLAKVEKLPRILERIRLSLTQPPGYLRQQSSPPLTDNRNLSETS
QATYQSLQRNIFRFNDPTCGSTPNTSPCHRSNTSTLTNECPVGNNNGNTRSPIVTRASTL
PRNAFHPSPKLQPAKITSEYNNDLTQSPARQRFACGSPCHQAPVKPKNRVITSSLTNGMN
GNVNGNGNLDEMSDLLRYADDEMTEPVNNGSQISISQLSNVASSGYQSFAYSQSSSPVDL
TITNNNNNNNNNNGNHPIVVNNNIHANAAPLAFTNPVYHMDQRRQQVRRRHSCSSSSEEN
GTGADLSPTPSTPTPPVNRRFAGIRAPRTNPQCSLRNNWRAVTNHQPASVNHSKQNLLEN
EINKSGCPKLRRRLSLDSTRDITDSSDDESCQNHRVHSRIGRSIDQSQYEREIERLKSSV
DFLKFDQTSEHSGKSSPDPSLDRSESNMKSIISRLISVEEELLREQQKMSDTLTHKQRVI
EAQEHQIAVLGADNNRLRTALATLTEHYASEAQDKRILAELNELKSSSC
Download sequence
Identical sequences E0VLX6
121224.XP_002427120 XP_002427120.1.24195 vb|PHUM297000-PA|EEB14382.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]