SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002429476.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002429476.1.24195
Domain Number 1 Region: 10-229,427-520
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.94e-77
Family Rhodopsin-like 0.00027
Further Details:      
 
Weak hits

Sequence:  XP_002429476.1.24195
Domain Number - Region: 267-302
Classification Level Classification E-value
Superfamily PH domain-like 0.00139
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002429476.1.24195
Sequence length 529
Comment class A rhodopsin-like G-protein coupled receptor GPRnna3, putative [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MAKDNNVTVDEESFNATTDFLPNQFSRFYQLTWEDLALATVLCIFIIITVVGNTLVILAV
IVTKRLRTVTNCYVMSLAVADWLVGVFVMPPKVALHLMGSWELGEIFCDIWISLDVLCCT
ASILSLCAISVDRYLAVTQPLNYSRRRRSKKLALLMILIVWLVAIAITCPPIFGWYDVNH
HKDKQCRYNQNEGYVIFSAMGSFFIPLIVMLYVYARISCVVSKRHEKLRQVENNSKTLNE
RSSRYAAILYRQTGRMRYEKRTNKFPGFFLKKKGEKVSFWKMNFFRLKNQKFISYNDESD
YMERSFNDDDKCHHNPIMKSTSLSNSEHSQYTITSTTTTSGTHHHHHHHHNHNQRSIRSH
YSYHNNQNNHSVSTELCSSSSSSHTTGKGNYYGNMNRTAGRPQGGITMDHLTQTGEQSCN
LKYSSSSRVSSFRRESKTTQTLTIVVGGFVACWLPFFITYLMAPFLPDCTIPNLLWSLLT
WLGWFNSAINPFIYAFYSVDFRTAFWRLTFQHCITTQKWQQQQFRNRNK
Download sequence
Identical sequences E0VTL1
vb|PHUM434300-PA|EEB16738.1|class 121224.XP_002429476 XP_002429476.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]