SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002430190.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002430190.1.24195
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.45e-29
Family Ubiquitin-related 0.0000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002430190.1.24195
Sequence length 99
Comment conserved hypothetical protein [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MGDNQKADSGPVDASSDYIKLKVVGNDSNEIHFRVKMTTQMGKLKKSYSERVGVPVTSLR
FLFDGKRINDDETPKQLEMENDDVIEVYQEQTGGCWLCQ
Download sequence
Identical sequences E0VVP6
121224.XP_002430190 vb|PHUM466280-PA|EEB17452.1|conserved XP_002430190.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]