SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002432099.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002432099.1.24195
Domain Number - Region: 23-73
Classification Level Classification E-value
Superfamily PH domain-like 0.000646
Family Pleckstrin-homology domain (PH domain) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002432099.1.24195
Sequence length 88
Comment hypothetical protein Phum_PHUM569730 [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MHIWLWFAVTIIIVVLTIENGEIVAKEDEVPLFVHHASNVSKFCLEPGNMRTFMYLVRDK
FEPVLNVYLFQSDCCEDVSALNFIYLFI
Download sequence
Identical sequences E0W155
121224.XP_002432099 vb|PHUM569730-PA|EEB19361.1|hypothetical XP_002432099.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]