SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002432217.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002432217.1.24195
Domain Number 1 Region: 20-130
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-27
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 201-271
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000288
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00048
Further Details:      
 
Domain Number 3 Region: 360-461
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000131
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002432217.1.24195
Sequence length 474
Comment Neural Wiskott-Aldrich syndrome protein, putative [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MPGRPSNESRLLLKEENILLFSLLGVKCQSLASSVVQLFLTESPNHSQWKRKDAGIMCLV
KDHTKRSYFFRLYCLSRKALVWENELYNSLEYTAPRAWLHTFEAESCMAAFNFADEEEAN
HFQNEVLRTLASKNQKQIERRARNSRQMDGYQGPITNVQHTSYVHNGPDIMQHKKKIAGN
GTKGRDRRRRLRKEDIGQPQDFRHVSHVGWDANRGFEGHGEALENPQLKEILCKAGVSEN
QLRDRSTREFIYGFLERVGGLPPVKNESTKLAKAPPVPSRAPPPAYPLSKPLPSPPTNNI
NTRRQIPPPVNNQRVAPPPPPPPPMSSLPKLPENDKSRNTVAPPPPPPPPPPPLITSEPA
TPPPVPRPSNSSTDARAALMDAIKSGATLKHVDVEKKSVNHMDSRGELLDQIRQGVELKS
VQHVEKPNGPSAPLDGIAGALARALAERSKAFHHDSDSDSDSEGDGDSDSEWDE
Download sequence
Identical sequences E0W1H3
XP_002432217.1.24195 121224.XP_002432217 vb|PHUM577310-PA|EEB19479.1|Neural

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]