SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002433146.1.24195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002433146.1.24195
Domain Number 1 Region: 363-546
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.71e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 274-342
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000181
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.015
Further Details:      
 
Weak hits

Sequence:  XP_002433146.1.24195
Domain Number - Region: 45-108
Classification Level Classification E-value
Superfamily Tropomyosin 0.051
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002433146.1.24195
Sequence length 586
Comment Rac GTPase-activating protein, putative [Pediculus humanus corporis]; AA=GCF_000006295.1; RF=representative genome; TAX=121224; STAX=121225; NAME=Pediculus humanus corporis; strain=USDA; AL=Scaffold; RT=Major
Sequence
MTWESSLLWLLDEYRQSISFLQNDCTEEFLTFVIHQEQCRLKWKESVLECQRLKSDIDLC
NEKLQDYEKKLNRARCLLDAEKKKRLKAESERDELQEQVTQIEEILSTVRCAGDKLANET
KEKLDKFLSTTHSKLKPNTDTLGYQLNTIDEINSTGSLLSDLSYTRSEDFDYEPQTEKPR
SRKLLRSTSPDINEFQINKKRKSAWSQNQVNKIEKVSSEQLIATTTVTVPKQGPIVACST
IETYPQAYYKDTKPSAPPKLSSDTDSEVTEAINCFSHNSNPIYSKNKLFNRIHCFRNKTN
LKPSEECSVCVKKITFGNKMFYCSDCRVMVHPECRDKAPMPCLAIVATPRGTSGTTIADF
CSRTPPMVPPLIVHCVFEVEARGLGEVGIYRIPGSEKDVRALKDRFLRGKGVCSLSGYDI
HVVCGTIKDFLRSLSEPLVTFSLWPEFIRASENEDVSERTSALYQAVSQLPQPNRDTLAF
MMQHLQKVSQSPDCKMSKSNLAKVFGPTIVGYSRIEPVRNEMYVETAQQSQVIECLLDMP
GEYWYNFVNNEPDENIQPSTPVLSLDYRRLNRNKNRKVFNTPPVAK
Download sequence
Identical sequences E0W452
vb|PHUM615410-PA|EEB20408.1|Rac 121224.XP_002433146 XP_002433146.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]