SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002434383.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002434383.1.51680
Domain Number 1 Region: 24-100
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-18
Family I set domains 0.025
Further Details:      
 
Weak hits

Sequence:  XP_002434383.1.51680
Domain Number - Region: 130-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00984
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002434383.1.51680
Sequence length 168
Comment titin, putative [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
MCEEMLKPAQAKWLRSTSRADAYRRLQLRCKLNGNPIPWVQWYFMGKPIASNARVHIITK
WRRSRLEIKSARRQDSGLYECRAWNVLRKEPSVVAVNVTVRDRIPPPPTPPEPTRSTAST
TTNGRPCPLVSYCLNGGTCIFYEAVKEPVCQLDLHQLQGVTEPIREKI
Download sequence
Identical sequences B7PKT5
6945.ISCW006065-PA ISCW006065-PA XP_002434383.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]