SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002434559.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002434559.1.51680
Domain Number 1 Region: 28-129
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.77e-33
Family Calponin-homology domain, CH-domain 0.0000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002434559.1.51680
Sequence length 133
Comment alpha-actinin, putative, partial [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
LTLLQYWLIGLRGLVQECQAMAERRGLKALELWCRRVTEGYRDVRVCDMSASWRDGLAFC
ALIHHFRPDLIDFDGLRKEEVLANNRLAFSVAEAQLGIPALLDAEDMLAHRDPDRLSVAT
YVSQFYQYFEGGQ
Download sequence
Identical sequences A0A1S4LT73 B7PLB0
6945.ISCW018751-PA XP_002434559.1.51680 ISCW018751-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]