SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002435193.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002435193.1.51680
Domain Number 1 Region: 424-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000307
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 2 Region: 333-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 472-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 4 Region: 384-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000123
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002435193.1.51680
Sequence length 615
Comment laminin alpha-1, 2 chain, putative [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
MAHLDEDHGSLRLDLRVPRAGPHALVFFYHSLDNDGSVAADLVLSGADRLATGRANFHHC
NYNLLCRQVVLDHSGRVLELELRGNEEPLQVTLDLSVPSGELALERLVAVPLDQWHTDYL
LPQEECIRRANGECQPTPFPSFSPASKVEFESGAEPAVELPPTLMDNSTVLVLVDERNPS
VHVEGNVSEPGRYVLVVHYYQPDHPAFELDGVVQSGDSNQEARLPLAHCPWAAGCRAVLA
NAQGGSPAFPLLDNFTLTLGDPGRKSAWLDHVMLIREDQFDESLLGPLPLDKAVDFIKQC
GQNSFHMTANTSELCKEAVFSLTSEYNNGALPCQCNIDGSLSFECERFGGQCACKENVIG
RTCSQCRTGYFGFPSCRPCDCPNTAVCHPITGQCICPPRVMGDKCDTCMPLTFGYTRIVG
CEECNCHPQGVQGNNLQCDLQSGQCKCKTSIVGRTCDECKWGYWDFPRCRLCNCDLRGTV
EDICNQDTAECFCKENVEGDSCDVCKPGTFFLEESNPVGCTKCFCFGTTDRCNSALIFRS
QVTSYGGTLAYSLVATADNLVDFGSVIGPDVVLRGNNLTLVHEHVEQPAAGVPLEVHLRL
VEMPPTAKENGAEIA
Download sequence
Identical sequences B7PN45
XP_002435193.1.51680 ISCW006728-PA 6945.ISCW006728-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]