SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002436151.1.51680 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002436151.1.51680
Domain Number 1 Region: 35-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000267
Family Growth factor receptor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002436151.1.51680
Sequence length 116
Comment secreted protein, putative [Ixodes scapularis]; AA=GCF_000208615.1; RF=representative genome; TAX=6945; STAX=6945; NAME=Ixodes scapularis; strain=Wikel colony; AL=Scaffold; RT=Major
Sequence
MSFTSPSAKFTNNVSFFYLLRNSVLSNSPLNCKEVDCDEVVCSSAACTCGSHKSECGCCD
ICNKCPGETCITIHDDLCQEGYECKLKDPAGNIFGGDPGSCVPKTETPHDPAQNHT
Download sequence
Identical sequences B7PQV9
6945.ISCW005661-PA ISCW005661-PA XP_002436151.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]