SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002436726.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002436726.1.57931
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-35
Family spliceosomal protein U5-15Kd 0.000000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002436726.1.57931
Sequence length 142
Comment thioredoxin-like protein YLS8 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLAAVAETIKNFAVIYL
VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
RGARKGRGLVIAPKDYSTKYRY
Download sequence
Identical sequences A0A0D3HEX9 A0A0D9XKV4 A0A0E0EZ61 A0A0E0FFX0 A0A0E0M906 A0A0E0R0M1 A0A1E5VL61 B6T4C6 B8B881 C5YKW0 I1Q8W5 J3MJB5 K4AGE3 Q7X873
LOC_Os10g34520.1|13110.m03073|protein OPUNC10G12310.1 OPUNC10G12320.1 Si037950m|PACid:19679687 Pavirv00014263m|PACid:23799923 ORGLA07G0055700.1 OBART10G13860.1 GRMZM2G108277_T01|PACid:20866416 39946.BGIOSIBCE024080 39947.LOC_Os10g34520.1 4558.Sb07g020280.1 4558.Sb10g007680.1 OB07G14970.1 OMERI07G05290.1 OMERI10G10380.1 jgi|Sorbi1|5058721|Sb07g020280 jgi|Sorbi1|5061525|Sb10g007680 LOC_Os10g34520.1|PACid:21886447 GRMZM2G108277_P01 NP_001148867.1.34533 XP_002436726.1.57931 XP_002444330.1.57931 XP_004982785.1.39314 XP_006657540.1.55871 XP_015612821.1.37577 XP_015646995.1.37577 OsIBCD022672 ONIVA01G02590.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]