SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002437194.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002437194.1.57931
Domain Number 1 Region: 500-802
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-74
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 61-204
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-26
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Domain Number 3 Region: 336-384
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000224
Family Hairpin loop containing domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002437194.1.57931
Sequence length 816
Comment putative receptor protein kinase ZmPK1 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MNESSASLLLLTLIHLLSLVTAYDFLSAASSLSVEHSSDVLHSPDSTFTCGFYSISPNAS
TFSIWFSRSSKRTIIWSANPLHPVYTWGSKVELDVDGSMVLKDYNGQIVWTNNVSASDAG
HDVRARLLDTGNFIVTGKDGAILWQSFDSPTDTLLPTQIITAPTKLVSTNRLLVPGHYSF
HFDDQYLLSLFDDEKNISFIYWPNPSRTIWEKLRVPFNSSTSGAFDTWGHFLGSDNTTFT
AADWGPGIMRRLTLDYDGNLRLYSLNMADRSWSVTWMAFPQLCKVRGLCGENGICVYTPV
PACACAPGFEVIDPSERTKGCRPKTNISCDVQMVKFAKLPHTDFFGYDMTVHHPVSLDFC
KNKCLNDCNCKGFAYWEGTGDCYPKSVLLGGVTLHNLGSTGTMYIKIPKGLEVLEASIPQ
SQPFGPKYGPDCSTTNKYFIADFLDMLKRDQSESKYLYFYGFLSAIFLAELMFVVLGWFI
LRRECRELRGVWPAEPGYEMITNHFRRYTYRELVSVTRKFKDELGRGASGIVYKGVLKDN
RTVAVKKLGEIDQSEEEFQHELSVISRIYHMNLVRVWGFCSDGPHRILVSECFENGSLDK
ILFGSKGSKIILGWKQRFDIAVGVARGLAYLHHECSEWVIHCDMKPENILLDENLVPKIA
DFGLAKLLNRGGSNINVSKIQGTRGYLAPEWVSSLPITAKVDVYSFGVVLLELVLGERVS
NMENNEDVEAEMVLGRVSRLLKEKLQLDDIELSWIADFVDARLNGEFNNLQARTMMRLAI
SCLEEDRDRRPTMENVVQILVLVEDVSGPNVMARVI
Download sequence
Identical sequences jgi|Sorbi1|5031841|Sb10g022720 XP_002437194.1.57931 4558.Sb10g022720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]