SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002443672.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002443672.1.57931
Domain Number 1 Region: 546-859
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-69
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 104-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000563
Family alpha-D-mannose-specific plant lectins 0.006
Further Details:      
 
Weak hits

Sequence:  XP_002443672.1.57931
Domain Number - Region: 410-441
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0122
Family Pan module (APPLE domain) 0.035
Further Details:      
 
Domain Number - Region: 140-298
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0129
Family DPP6 N-terminal domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002443672.1.57931
Sequence length 925
Comment G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MRKRAPLPCPWRRLSRLILLLSVSLSAAIAAADARSVPVEYLYPTFNLTYIHSIDTNGVF
LHSPSANFSAAIYNAAGAGGGLSSSDDSQSRFFFSVLHTASRTPVWTATTTGSTMFNSIV
LSLAPTGIALYDPSAAKPDDPVWSTPRLREPVAALRLLDTGELALIDSRNTTLWSAFDRP
TDTLLPGQPLLLGSGSPLTSSASDRDLSPGAYRLVLTSNDALLQWATNASSSAAAFLTYW
SMSSDPAALQDSNQAVASMAVNSSGLYLFAANGRDTVYRLLFPSPPASKSESRILKLYPS
GRLRAVALTAAATVPTVWAAPANDCDLPLPCPSLSLCTPDANGSTCTCPDAFSTYSNGGC
EPADGSALPAIADTCAKQEATTTRYSYVSLGAGIGYLPTKFAVADTSGDELPACRDLCSA
NCSCLGFFYKNTSRSCFLLRNQIGSVFRAGADVAVGFIKTLPSQQQQRGNKGSSSSLSMI
TIVFGIVFPTVVVVLISLLLYAMLRRRRPQQVKKKSSSSWFKLPAILSSSRAASSAPSDS
EGLDEDVLIPGLPTRFTYADLDAATDGFRWQIGSGGFGSVFRGELPDRSTVAVKRMNGLS
TQGRREFLTEIAVIGNVHHVNLVKLRGFCAEGAGRQLLVYEYMNRGSLDKTLFRTGAGAG
TVELLEWAARLRVCVGAARGLAYLHAGCDRKILHCDVKPENILLDDHGGVKIADFGLAKL
MSPEQSGLFTTMRGTRGYLAPEWLMNAPITDKADVYSFGMVLLEIVRGRKNSKKQGEEEH
HGSSASSSSDRDDTSGGGGYFPALALELHEQGRYDDLVDPTLEGRADVAQVERVVRVALC
CLHEDAALRPSMTVVSAMLDGSMEPGEPRPELLRYLRVYGRGLVDLRPAAAGWMDQGKPN
DAGGRVSSSWSPPSCVSAQQLSGPR
Download sequence
Identical sequences C5YT42
4558.Sb08g023250.1 jgi|Sorbi1|5045669|Sb08g023250 XP_002443672.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]