SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002447173.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002447173.1.57931
Domain Number 1 Region: 524-805
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-73
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 75-185
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-26
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002447173.1.57931
Sequence length 840
Comment G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MDTILFIHLLLLPFMLLCPIAIAADVSDTLGKGRNITDGETLVSADGTFTLGFFSPGAST
KRYLGIWFSASSVAVCWVANGDRPVNGNSGVLVVRDTGSLLLLDGSGQTTWSSNSTSSSS
SAEAQLLNSGNLVVRDGGSSSSSSDILWQSFDHPSNTLLSGMKLGKNKWTGAEWYLTSWR
SADDPSPGAYRRALDTSGLPELVVWQGNVRTYRTGPWNGRWFSGIPEVSAYKNLIWYQVT
TSPAEISYGYTSNPGAALTRVVLTDAGMAKRLVWDAGARKWQTFFQGPRDVCDAYGKCGA
FGLCDAGAASTSFCGCLTGFSPASPPAWSLRDTSGGCKRDVKLDCANNGSGTSTTTTTTD
GFLLVHGVKLPDTRNATVDMSITVEDCMARCLANCSCLAYAAADIRGGDVRSGCVMWTDD
IIDLRYVDKGQDLYLRLAQSELPPAPSPQRRPFPTAPVAGASAAAVAVILIVLLVVVVIR
RRRQPIIPAVPAPSVPSTELRRPPSVPFAGQPSPVLNVPSAELSALRTATNDFSVDNVIG
RGGSSTVFEGNLTDGRKVAVKRVTQSYLTDEGVEIFMREVEVMSELKHDNLAQLLAYCKD
GNERILVYEYMENRSLNLYIFARDRNQRALLNWERRLEIIVGVAKGVAYLHGLSKEVIHR
DLKPSNILLDENWRAKIADFGTAKVFVDGQTNPTLVQTEGYRAPEYTVQGPHLTLKCDVY
SFGVVLIEIISGLKNSSTPKLLSDAQESWNQHKIKEDLLDSAVGQPEPETLLRLERCVQV
GLLCVQQSPVDRPSMAEVVAMLTTNGGSSSSSSSSSSSQVRGPLATQDAPGAHGDSIYLT
Download sequence
Identical sequences C5YGP5
XP_002447173.1.57931 4558.Sb06g029790.1 jgi|Sorbi1|5042606|Sb06g029790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]