SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002447380.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002447380.1.57931
Domain Number 1 Region: 215-277
Classification Level Classification E-value
Superfamily RING/U-box 1.57e-17
Family RING finger domain, C3HC4 0.0029
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily PA domain 0.00000000942
Family PA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002447380.1.57931
Sequence length 501
Comment receptor homology region, transmembrane domain- and RING domain-containing protein 1 isoform X1 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MKSSRFLFLCAMFCLMARLGAANVVLMGNNLTLSFDDIEASFSPGVKGSGVSGVVYASEP
LNACSPLTIKTVNGPPSPFALIIRGGCTFDEKVKNAQDAGFKAAIVYDNKNSGVLVSMAG
SSSGIHIYAVFVSKASGEVLKKFSGNMDVEVWILPTFENSAWSIMAISFVSLLAMCAVLG
TCFFVRRHRIRREHPRIAEDREFHGMSSQLVKAIPSLIFTKVQEDNCTSSMCAICLADYN
VGEKLRVLPCRHKFHAACVDLWLTSWRTFCPICKRDARSGASEVVATEATPLLSSAARLP
SFRSSVAASPPRPISRHPSSHSVSRAYSVSSTPNSPNPFISSHISSPGIRASRSITDLGN
ISSLHPRISHLSSTHSLVGSHLSPPISIRYWSSHVAHSGYGSPSPHVSSSYISNSGYGSS
SYCYLGLGGSSHSQHGTYLRRCGESGPSLCTMVPQQLQWETNVAAGASSAKSLRQSSYLR
HCGDSDASLSDMTSAQSLPRC
Download sequence
Identical sequences C5YB45
jgi|Sorbi1|5058208|Sb06g034040 XP_002447380.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]