SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002450144.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002450144.1.57931
Domain Number 1 Region: 99-173
Classification Level Classification E-value
Superfamily PA domain 0.00000068
Family PA domain 0.012
Further Details:      
 
Weak hits

Sequence:  XP_002450144.1.57931
Domain Number - Region: 512-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0031
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 301-399
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0537
Family Thioltransferase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002450144.1.57931
Sequence length 627
Comment vacuolar-sorting receptor 1 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MGSRSAASAALRIWLLVSVALLLGCCQGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQ
YGGTMVGFVAYPKANRKACKSFDDFDISYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAG
AAAILVADDKDEPLITMDNPEESGNTDYLENITIPSALITKSFGDRLKKAIDKGDMVNVN
LDWREALPHPDERVEYEFWTNSNDECGPKCDSQIDFVKSFKGAAQVLEKKGYTEFTPHYI
TWYCPEAFILSKQCKSQCINHGRYCAPDPEQDFSKGYDGKDVVVQNLRQVCVFKVAKEHK
KPWLWWDYVTDFAIRCPMKEKKYTKECAEGVIKSLGLDHKAIDKCIGDPDADEENPVLKA
EQDAQIGKGSRGDVTILPTLVINNRQYRGKLDKGAVLKALCAGFKETTEPAVCLSEDIQT
NECLENNGGCWQDKAANITACKDTFRGRVCECPVVKGVKFVGDGYTHCEASGSGRCEINN
GGCWKDTKNGRTYSACTDDGCKCPDGFKGDGKHKCEDIDECKEKTACQCKECKCKNTWGS
YECGCSGGLLYMREHDTCISKNGGSEAGWGFLWVVFFGLVAAGIAGYAVYKYRIRRYMDS
EIRAIMAQYMPLDNQGDVQSHSHHIEM
Download sequence
Identical sequences C5Y3H0
jgi|Sorbi1|5056269|Sb05g001160 XP_002450144.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]