SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002451801.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002451801.1.57931
Domain Number 1 Region: 230-314
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00079
Further Details:      
 
Domain Number 2 Region: 144-217
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002451801.1.57931
Sequence length 688
Comment far upstream element-binding protein 2 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MADDHYSSKRKYDDPSPPPRRTGFSSGPPPASPPAGGAPSYNSVPPPPDEIQLAKQRAQE
IAARIFNAAEAKRPRVDNGDDDVGGYGGGGTLGGSGGGGGGRIGGGGLGFSSSAGGGYGA
SIPPLSSQSSAPQYSSYGGYQGTSKKIEIPNGRVGVIIGKAGETIRYIQLQSGAKIQVTR
DHEAEPGALTRPVELSGNPDQISKAEQLIKEVLAEADAGSSGGGSGRKYNAPQPGGETFQ
MKIANNKVGLVIGKGGETIKSMQQKTGARIQVIPLHLPAGDTSTERTVHIDGTPEQIESA
KQLVIEVTSENRARNPMSGGYSQQGYRPPRPQSNWGPPSAPPQQPGYGYMQPGAYPGAPP
QYGAPQQPYGSYPPTSGGYQTGWDQSQNQQSHTTPPGTGYDYYSQQQQPQQQQSAPGTAA
STDATSYNYGQPSTYASQGYDSTYTQQSGGQQAYGHDGYSGYQTQGQQQGYSQQTGYDQQ
GYGASAYGSAANSTQDGSAASYGGPGGASQASPGQQSSTPAASHPGYASQPPTSAAASYP
TQGSAPSGYGAPPPQSGYGTQPPGYGQGAYGQPSPQGQKPPASSPYGQAPPPGSAQGGYG
QYGYSQPAYGAPPAYPGAPHSSHPGYGQQQSYGDAYGSGNYGQPPAYSTEATAAAASQDH
SAAPAAAPATTAAPAPDNSGGAQTSAET
Download sequence
Identical sequences C5XYG2
XP_002451801.1.57931 jgi|Sorbi1|5054916|Sb04g007950 4558.Sb04g007950.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]