SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002452918.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002452918.1.57931
Domain Number 1 Region: 117-162,190-392,499-627
Classification Level Classification E-value
Superfamily Subtilisin-like 3.4e-77
Family Subtilases 0.0072
Further Details:      
 
Weak hits

Sequence:  XP_002452918.1.57931
Domain Number - Region: 374-447
Classification Level Classification E-value
Superfamily PA domain 0.0157
Family PA domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002452918.1.57931
Sequence length 780
Comment subtilisin-like protease SBT1.4 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MARLASALCVLLAAAVAVPAAVATESEAVEPVSTYIVHVAPAHAPRLSRPRALSGAYRSF
LRDHLPARVARPAPRLLYSYAHAATAFAARLTGAQAAHLASQRSAVLAVVPDATQQLHTT
LTPSFLRLSESSGLLQASGGATDVVIGLIDTGVYPKDRASFDADPSLPPPPSTFRGRCVS
TSAFNASAYCNNKLVGAKFFGLGYEAAHGGEVGETDSRSPLDTNGHGTHTSSTAAGSAVA
NAAFFDYGKGTATGMAPRARIATYKACWARGCASSDILKAFDEAIKDGVNVISVSLGAVG
QAPPFYSDSTAVGAFSAVRNGIVVSASAGNSGPGEFTAVNVAPWILTVGASTLNRQFPAN
VVLGSGDTFTGTSLYAGTPLGPSKLPLVYGGSVGSSVCEAGKLIASRVAGKIVVCDPGVI
GGAAKGEAVKLAGGAGAIVVSSKAFGEEALTTPHIHPATGVSFAAAEKIKKYIRTSASPV
ATIVFIGTVVGGTPSSPRMASFSSRGPNLLAPEILKPDVTAPGVDILAAWTGENSPTELD
SDTRRVKFNIISGTSMSCPHVSGIAALLRQAWPDWSPAAIKSALMTTAYNVDNAGDIIKD
MSTGTASTPFVRGAGHVDPNRALNPGLVYDVGTDDYVSFLCALGYTARQIAVLTRDGSTT
DCSTRSGSVGDLNYPAFSVLFGSGGDEVTQHRIVRNVGSNVRATYTASVASPAGVRVTVE
PPTLKFSATQQTQEYAITFAREQGSVTEKYTFGSIVWSDGEHKVTSPISVIWLASQAAEM
Download sequence
Identical sequences C5XTM2
XP_002452918.1.57931 jgi|Sorbi1|5039111|Sb04g034950 4558.Sb04g034950.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]