SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002454086.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002454086.1.57931
Domain Number 1 Region: 124-623
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-164
Family Calponin-homology domain, CH-domain 0.00000000000196
Further Details:      
 
Weak hits

Sequence:  XP_002454086.1.57931
Domain Number - Region: 12-92
Classification Level Classification E-value
Superfamily EF-hand 0.000574
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002454086.1.57931
Sequence length 672
Comment fimbrin-5 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MSTFFGVLVSDPALQSQFTQVQLRTLKTKFTSAKRPNAEHVTIKDLPPVMEKLRGIHEVL
SEEEVSKFLSETYPDMNQPIEFEPFLKEYLNLQAKGTSKSGGKKKLKGSVSFLKASTTTL
LHVINESEKTSYVNHINNFLKEDPFLKTFLPVDPASNELFNLVRDGVLLCKLINVAVPGT
IDERAINTKKDLNPWERNENHTLCLNSAKAIGCTVVNIGTQDLIEARPHLVLGLLCQIIK
IQLLADLDIKKTPQLVELVADDNGKGAEELVTLAPDKMLLKWMNFHLKKAGYKKTVTNFS
TDVKDGEAYAYLLSTLAPELSSKTMIETSDPKERAQKVLETAEKLDCTRYVTSKDIVEGS
ANLNLAFVAQIFQNRNGLSTNTVAPVHQDTPDDVEASREERAFRLWINSLGIPTYVNHLF
EDVRTGWVMLEVLDKISPGSVNWKHASKPPIIMPFRKVENCNQVIKIGKELNFSLVNVAG
NDIVQGNKKLILAFLWQLMRTSILQLLKNLRSHSKEKEITDADILIWANNKVKESGKTSH
IESFKDKTIADGVFFLELLSAVQSRVVDWNMVKKGEDEDERKLNATYIISVARKLGCTVF
LLPEDIMEVNPKMILTLTASIMYWSLQNQGPYQCPRPQDALPEEEEGEEEEEEEEEEDFE
GGVEDGVSETTT
Download sequence
Identical sequences C5XWE1
4558.Sb04g024410.1 jgi|Sorbi1|5038547|Sb04g024410 XP_002454086.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]