SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002456088.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002456088.1.57931
Domain Number 1 Region: 69-162
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.02e-22
Family Cold shock DNA-binding domain-like 0.00095
Further Details:      
 
Domain Number 2 Region: 157-237
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00077
Further Details:      
 
Domain Number 3 Region: 10-69
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 4.18e-17
Family ECR1 N-terminal domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002456088.1.57931
Sequence length 239
Comment putative exosome complex component rrp40 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MESRKPAPSPLVDNYVVPGDVVLDLSEMNNQTIKLGAGLRQECDTIQATSAGKLRLLKPN
KYWIENSQKRYIPSVEDTVLGIVVDTKPDNFLVDIKGPNLAFLPVLAFEGGTRRNIPKFE
IGTLIYARVVKANSIMNPELSCMDASGKAAEFGQLKDGYMFDTSTGMSRMLLSSPTCPVL
EALGKKLSFEIAVGLNGRVWVNAPAASTVILVSNAIMRSESLSGIKQRAMVENLLERLS
Download sequence
Identical sequences C5XFW6
4558.Sb03g030230.1 XP_002456088.1.57931 jgi|Sorbi1|5053463|Sb03g030230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]