SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002464428.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002464428.1.57931
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-41
Family Calponin-homology domain, CH-domain 0.0000531
Further Details:      
 
Domain Number 2 Region: 199-254
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 9.94e-17
Family EB1 dimerisation domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002464428.1.57931
Sequence length 317
Comment microtubule-associated protein RP/EB family member 1C [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MAASNIGMMDGAYFVGRNEILAWINTTLQLGLSKVEEAASGAVACQLMDAAHPGAVPMHK
VNFDAKTEYEMIQNYKVLQDVFNKLKITKHIEVNKLIKARPLDNLEFMQWLKRYCDSVNG
GFMTNYNASERRESSKGGKDTNRRASVPSHTPAKSATTGHKAQTSHGAKRASGQTASAPP
PRSAKPSPAANSGGPAPAYDEQITELKLLVDSLEKERDFYFTKLRDIEMLSQNPEVEHVS
VQTIQNILYASEEDAQQLPPALSPIMEASEERPKQEMANKRKSISDLDEFGMSSSSRQRL
SDISDVQLCGSPLTSFS
Download sequence
Identical sequences C5WX96
4558.Sb01g018110.1 XP_002464428.1.57931 jgi|Sorbi1|5048687|Sb01g018110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]