SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002466328.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002466328.1.57931
Domain Number 1 Region: 66-105,307-543
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.29e-70
Family FolH catalytic domain-like 0.000032
Further Details:      
 
Domain Number 2 Region: 112-325
Classification Level Classification E-value
Superfamily PA domain 1.83e-46
Family PA domain 0.0000541
Further Details:      
 
Domain Number 3 Region: 544-696
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 3.92e-30
Family Transferrin receptor-like dimerisation domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002466328.1.57931
Sequence length 711
Comment probable glutamate carboxypeptidase VP8 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MPHSVLARLPHGSIRLVVAFGLLLLVSLLVLHRRPGRPHAAAAAAGGRLSDPAGLFLSLS
PGANASIAADLRALTAGPHLAGTRASAGAAAHVLARLRAAGLRTLTREYEPLLSYPGHAS
LALLRPDGSLLARLSLEEPADVGRRVVRPYHAYAPSGGAVAEAVFVNLGREEDYAALERL
GVGVRGRVAVARRGGGYRGGVVARAAEKGAVAVLIAGNADGGVERGVVLLGGPGDPLTPG
WAATSGAERLGFDDKAVKRRFPSIPSMPVSAKTAAAIIRSLGGPAMPAEWKDGLGVDVGG
VGPGPTLVNFTYQEDRKFYKIRDIFGIIKGQEEPDRYVILGNHRDAWTYGAVDPNSGTAA
LLDIARRLGTMLQSGWKPRRSIILCSWDAEEFGMIGSTEWVEENLEDLHSKAVAYLNVDC
AVQGVGFFAGSTPQLDKLLVDITRQVKDPDVTGKMVHDTWNEMSGSIKIERLARTDSDFA
PFLHHAGIPSVDLYYGEEFPGYHTALDTYNWMEKHGDPLFLRHLAITEIWGLLALRLAND
PVLPFDYQAYTSDLQEHIKTFSALTDNGHAVNLMNGFVNDLSGAAMEVVKEMKKLQQLDL
YDDHARMRRRLLNDRLLLAERSFLQPEGLQGRGWFKHLLYSPPEDYESKFSFFPGIADAI
SRSANLSDKEREVAVQHEVWKVCRAIQRAASVLRGEFSERKPINFSSLVAP
Download sequence
Identical sequences C5WY45
4558.Sb01g005710.1 XP_002466328.1.57931 jgi|Sorbi1|5028190|Sb01g005710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]