SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002466921.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002466921.1.57931
Domain Number 1 Region: 546-833
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-82
Family Protein kinases, catalytic subunit 0.0000746
Further Details:      
 
Domain Number 2 Region: 88-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-23
Family alpha-D-mannose-specific plant lectins 0.0083
Further Details:      
 
Weak hits

Sequence:  XP_002466921.1.57931
Domain Number - Region: 371-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0549
Family Anti-platelet protein 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002466921.1.57931
Sequence length 885
Comment G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MRRRRCPLLVAGVLLLVLLLLLVLLLPTAVRGTDTVTLDSPLKGNRTLVSAGRAKYVLGF
FAPDPDGTAGRTPTYLGIWFNGIPDRTVVWVANRESPVLGGVDAAELTVLANGSLAIVVD
DDQPPGAVVWATPPGTTSSGGGNATAYAQLLENGNLVLRVPGAGVVWQSFDYPTDTLLPG
MKLGIDFRTGLDRRMTSWRAAGDPSPGDYTFRLDPRGSPELFLSRRSARTYGSGPWNGYQ
FTGVPNLKSNSLLTFRFVSNADEAYYSYGVVDGASAAVTTRFVLNSSGQIQRLMWIDMTR
SWSVFWSYPLDECDGYRACGAYGVCSVERNPACGCVPGFDPRFPAEWALRDGSGGCRRRT
ELNCTGGDGFAMLTNMKLPESANATVDMSLGLDECRRTCLGNCACRAYASANVSSPGATG
CFMWTGDLLDMRQFGNGGQNLFVRLAASDLPVSSSSADTDARTKRLVEIIVPSVAAPLLL
LAGLYICAMKMKKRRKEKEAIPLALLRNAQRQGTPFGRRNQIAASTDVQDDSLHDGQQGS
SNQDCDLPSFDVETIKGATGNFSVHNKIGQGGFGPVYMGKLDNGQDIAVKRLSRRSTQGL
REFKNEVKLIAKLQHRNLVRLLGCCIDGSERMLVYEYMHNRSLNTFLFNEEKQSMLSWEK
RFNIINGIARGILYLHQDSALRIIHRDLKASNILLDKDMNPKISDFGVARIFGTDQTAAY
TKKVVGTYGYMSPEYAMDGVFSMKSDVFSFGVLVLEIVSGKKNRGFYHTELDLNLLRYAW
RLWKDGESLEFIDHSIAETSNAAEVLKCIQIGLLCVQEQPKRRPTMSAVTTMLTCESPTL
PEPCEPAFSTGRNHSDDDEEEEEPEVKACRSDSASSWTVTVVEGR
Download sequence
Identical sequences C5WV97
4558.Sb01g016720.1 jgi|Sorbi1|5028815|Sb01g016720 XP_002466921.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]