SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002468934.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002468934.1.31404
Domain Number 1 Region: 122-172
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000106
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  XP_002468934.1.31404
Domain Number - Region: 1-30
Classification Level Classification E-value
Superfamily RING/U-box 0.00777
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number - Region: 60-112
Classification Level Classification E-value
Superfamily RING/U-box 0.038
Family IBR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002468934.1.31404
Sequence length 173
Comment predicted protein, partial [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
CGHYFDVPCLINLVEVATRDESLFPPSCCHQRILDRSFTRFMPSALRDVFAVKDVEFSTT
CRVYCAKPSCSRFLGARRKDSFAPVLSCPSPGCGTHTCSRCRGAVHPGRGHRCEHDSGQK
AVLELASQKGWARCPACDQMIELRSGCYHMTCVCAVQFCYLCKSLWKTCHCPR
Download sequence
Identical sequences A0A1X6N3W6 B8NZZ5
104341.JGI40363 XP_002468934.1.31404 jgi|Pospl1|40363|gw1.2.102.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]