SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002469027.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002469027.1.31404
Domain Number 1 Region: 251-321,351-567,622-731
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-79
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0016
Further Details:      
 
Domain Number 2 Region: 113-214
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-28
Family Zf-UBP 0.00014
Further Details:      
 
Domain Number 3 Region: 574-638
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000244
Family UBA domain 0.0036
Further Details:      
 
Domain Number 4 Region: 1-80
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000165
Family Zf-UBP 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002469027.1.31404
Sequence length 732
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MVTCGHLVEIARLQLPRLSQSVHREECTQCFDNQDHPLGIDVCLTCFNGGCLGKERHHAR
THVHKTGHGFSLNIKRKLKPSANRVDEEEPPAKMTKLAIVEDRDEDKYEFKTVLKCWKCE
PENGLEIPDAMADPHENLWLCLTCGSLGCGRQQYGGLGGNGHGLQHYQETRHPISVKLGT
ITPEGNADIYCYICNDAKQDPDLAAHLTTFGINVQTQTKTEKSMTELQIEHNLKFDFSLT
DESGKALEPVFGPGLTGLSNLGNSCYMASVLQTVFSLPVFRQRYYPSASTHWETCTETLP
ASCVDCQMHKLADGLLSGRYSHPRPTSSGASHPKETNPLAHDSPTPIFQEGVRPSGFKAL
IGKGHEEFSTMRQQDSEEFFTHLLTVLRRYAKKTGGMLNHDPTEVFAFGMEQRLECGECR
RVRYRVDGTDVVSVPVPARETGKNAEGRTQYAEVALGECLDILTGTEALEYTCPGCQKRV
IATKRSRFATFPQVLMVHAKKFQLVNWVPTKLDIPLNVSDTLQLDQSAPGLPQFNEAAMA
QLEAMGFPTIRCQKALLATGNNDAEAAMEWLFAHMEDPDIDAPIQAAGSGSSAPEPSQEQ
VSMLSEMGFTHAQARKALRETGGDAERAVEWLFSHPDDNGEDAAPSGSSETPESSGTGGS
AELPARYRLKAFISHKGPSVHSGHYVAHIRVEDAAVGGESWVLFNDEKVVKADEESVREL
KKLAYLYVYERE
Download sequence
Identical sequences B8P044
jgi|Pospl1|88236|fgenesh3_pm.3__20 XP_002469027.1.31404 104341.JGI88236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]