SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002469270.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002469270.1.31404
Domain Number 1 Region: 861-1068
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00037
Further Details:      
 
Weak hits

Sequence:  XP_002469270.1.31404
Domain Number - Region: 184-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000187
Family LIM domain 0.023
Further Details:      
 
Domain Number - Region: 214-267
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.076
Family LIM domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002469270.1.31404
Sequence length 1269
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MSSSADQGRQAVIQDVRGSQSNGDPSALAYMAPESDSNYTREHSPVSPRNGLLPSSSSSS
ANPPERAYLPHRASTFSFPHNVDQRKQRSDDHPHARSEDFNHSTSQSYGDSSSSDQALAR
PQPFLTASRPSTPGSSSQHTSDYTGSSKTPPGSVHSDSSLYTDNAALSGNAQTASSSTHT
STSIASTPCAACGKAMQGAFVRALGTVYHLQCFKCMDCGTVVASKFFPIDGPDGKQHPLC
ERDYFRRLNLICAKCGMALRGSYITACRCNSAILKQFVEINRNMRDECWHPECYMINKGQ
CTYIDGDLWQFWNVKVVARRPALPSNSEEFEGEPQEPPWTEEERRETAISLKEKQIRMEQ
QVYRIWTVLSAFEESSAACISDMLRQVSNGQYLEAIRMAEKFILHVEVLFATIDDLEWHF
ARLKLKGMSHVREARMLCRKTVDLFTLLSHTQETGARRMGMTQELLALVTGLAHYLKILI
RIALTGALKLEREHNVQEAITSFLDKLHMLAIQGGNPSAKRMMKRANGEVLALVDNGNTG
TQGVTYGFKSLAPENAGESPFMGAPRDPALAKVNVVNPPSDLCAKCNQTVEEDCVRLGTY
QRWHSHCLQCDTCGKVAAVPAQKEAVQARNLEDKEKEKEEKTPKLSTARRPPANVGYFVY
DADSMKDTTTFGPVPTKVYCVEHGHGGCKGGFMAVARLEQYAFLLNVALRRLYVVLKKXG
CRAVNPCQGQVIRPPFARNNTGVMIVDDSAPTSPTAAAVDEPTMPAIEDGITLADIPQIV
EAAQAREQHRSLPRQSSIPFIAELSTLELAIVRHCAVVVLSHSPLQSQFDLDEILELVEN
KKNSFWKQLFKPGNDKKNVKKKGVFGVPLELLVEREGADSLLGASRTAVKIPSFVDDVVS
AMRQMDLSVEGIFRRNGNIRRLKELTEAIDRDPSSVDLTQDNPVQLAALLKKFFRELPDP
LLTYKLHRLFIASQSLPTEQERMRMLHMVSLILPKAHRETLEVLSVFLKWVASFAHLDTE
TGSKMDLQNLATVICPSILYSRGRDAVRDESFGAIRVVTALLENQDELYCVPQEFLSILQ
DQDYFVNSLDLPSKEFLKKCETYMRLKASGRTPLLTSPVSGSAPFNPSTPRPEDMRAQPP
RSQTQPTGGQYGDRPAMANGVSSDSLIRNGQQQPRQQMSAPPLQHSPFSYPPPSSGMSAI
HAPQPRAPNVQSTSDDWTPPERQPYIGQVPSRPSSMSNSYVPSRSSGEGSNPFAPPNGHS
QQPAVRQRI
Download sequence
Identical sequences B8P0N6
jgi|Pospl1|96442|fgenesh3_pg.5__89 104341.JGI96442 XP_002469270.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]