SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002471679.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002471679.1.31404
Domain Number 1 Region: 709-778
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000442
Family LIM domain 0.03
Further Details:      
 
Domain Number 2 Region: 810-865
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000107
Family LIM domain 0.026
Further Details:      
 
Domain Number 3 Region: 861-888
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000164
Family LIM domain 0.016
Further Details:      
 
Domain Number 4 Region: 681-708
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000336
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002471679.1.31404
Sequence length 895
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MTRVAMRTETHLPRVIPYQSRRLLLPHLDRLLRTHPGRNISQPTATTAPQSLTRTTSPHT
PPHGVCFISPDCQAEPRHTNVAAFVAAEVYNLARSPSPSKIDRNEVQQPSLSEIAPMGQK
FVPHWRRALPTPGHPAGSPPAPLQPQQIERRSTVSGPVPPPIAQRQGNAIRPLPQSPAMP
GAGHGRSSSSSVHPLPPLPSAAPQTPAQSNSPPRRLPQPNIPRAARPGSSSTINSGTDST
DSEDLASHVLLSRPQTRPPVNGQRNGRQSPQYGILDMPSRMQSSANGSAEAQSVTLRLAS
MSVQDNQHGQTRDDTVLPNPGEQSSRPPSRTHGYSQSVPNASNVVLPHPMPPMTRTYAQS
GATRWPAGLPPLPKAPASNDGGGDDPSRRPGTFGRSTPTAGHRPPILDLSLDDAPPPSLR
RSPSPARSAAQSAPRHKPPSPVDPYRTAPASRSTGGRPQPASIRTQALNGTSSGPVFSTR
HELPSPSRSRAESPVSATTPSSAVSATSAFTLSAFPRPPSSTPPSSRSSSSPRDPQSAGS
AVSPLSAASPASANSTSSAFTLSSFPQPPSQVPSDHTFGRRIVGPSDQDHRDGAGYRQAI
PKISFPASGDDDDSEESDSDFGPVISVSGPGDHEPSIPSISIGPVDDTPDGLPQFSLTDE
TTKHPEEHVTPLLRAIRKGPGLTCGGCGGAIVGRTVSAMGARWHPGCFRCCVCNELLEHL
SSYEHEGRAYCGLDYHERFAPRCYHCKTVIVDERFITLDDPELGKRTYHDMHFFCAECGD
PFLAPSASSRAPAGGQTFSGDGIFSGGEDDVGFTVYRGHPYCEACHVRLRLPKCKRCKKA
IRDGKRAVEALGGKWCWECFVCASCERPFDNPAFFQRDGKPFCEHCFSIMIKNEM
Download sequence
Identical sequences B8P7Q6
jgi|Pospl1|93444|fgenesh3_pg.41__96 XP_002471679.1.31404 104341.JGI93444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]