SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002472212.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002472212.1.31404
Domain Number 1 Region: 64-138
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000194
Family FAD-linked reductases, N-terminal domain 0.00093
Further Details:      
 
Domain Number 2 Region: 161-295
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000085
Family Glutathione peroxidase-like 0.0069
Further Details:      
 
Domain Number 3 Region: 3-62
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000259
Family PHBH-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002472212.1.31404
Sequence length 1283
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MEGNPAGLTWGVMDFIPDTNFPTTQAKNIIQSPLTGILGIIERGFLPYSMKAKEITWCSQ
YKGHIHSPNAGQGANVSMSDAYNLAWKLAYALSGQATSGILDTYEEERRPCSIELINLDE
ELHKLNRPDSLFANEYVNCIAVFISALDSFKARTCSQLEGFQSLAPRLPLGQRLPPGDIL
RYSDWNPCNLHDLIRYSLSFKVIIFPGNLLEADVATHLSDFVTSIATSLDDTKQSMIETS
VILRSSKYALPQVPDLADMLSDSRLYLDDDEHTSETEWHDRLYRTLGISEEGVATLLDPA
LPEKQPLDVVLTGSAVTARGRSPPQASLTTRPACIALQNEDRDEDAVVITSLNVIPFCCH
ADLLTMSRAELVVVADTLNARLPRILNIDVGRSRSAAYIRKSIELLVGLRKDATQTPEAE
RSRSVFTGVGEVSHSAGSPGLLDNATQQDASTGSVALEDSQEGFRDPDVASHRPQKKRRF
DAEATVEASDRPMISRPITRSQSHQDPQPEFTGAEANAERHPSKHYRGPWKVLFSTSWIP
ALTKHGDDLDAKGTEVTWCRSGSATTLSGRGFSFRFTHLQSRVAYRGEGEAYLEAQAGSD
TPGYDGPDVRDRGADDAAYRFGFGYAQRHCVEAMVKNYTYYIHVYCSKANVRHFGASVPD
IAFICLLISEQPEIFLTALNTGGGLIPVEDVIALAFAYLFRIVLMDRFAVRWKNLLHDHS
VSHVSQPETNAHQYLLARFVVALTTVSLFTALNCTMHAFLFGLLRSVVLPLLYMMPIVPQ
FLRPFTAHFLRGSWTMTLFFRHWSLLWRSFFLCLTTTTCWEMAESPLDEPVTVAHTTADP
VLTVVSGITSADGYFKHFAYAELSQLARGYSPAASARRSALFADQKYNPSMWACLVRDAL
LTLGKDYQLLLRRGSPEAPAPAPAPAPPKPELTLPATPLKLLRTSVLKPTPTSPLRAALD
TLASDGAISSAADSGVSQIPELFRSMVHASPSAEKAIESVKRSEERVVGMFEETRTKLQQ
RMEAAVHGRVPAAALEKMTPAFGVVERVRQWWTRDRVNKLVEMSLPNRHLDALAISNSYG
VVQRDIPKIIEALLSFLAAVEEYQAEISKTHVTPSPEELQNMSAKERQEKERLMTELEQA
GQIFAEVNDGLKEGIVHIVRTFGDKLAAFRFPPRIAQKLQGYMLHDDVVIVLRAQITEWQ
GWGGIRSQKRRLCLACQQAFVTDSLLTIYNIKSFERECGGFHDSTPGTNFWDATVKTRRI
TFGPPFKETEGPPTGKLSAERHV
Download sequence
Identical sequences B8P962
jgi|Pospl1|104820|fgenesh3_pg.52__21 104341.JGI104820 XP_002472212.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]