SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002473061.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002473061.1.31404
Domain Number 1 Region: 105-228,328-347
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-19
Family SPRY domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002473061.1.31404
Sequence length 459
Comment predicted protein, partial [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
RKRKHAAISSTVASSPAPSDPGATPTPGAENVVLTSRHTDLSTRPRLDISRHPVFVPLYP
GSSYFSTEPLCNNRLNFRYTPAGLTPVGSLVPFRTIETVPTCSRVSWEDRSPFVRVTQDG
LGLKGEKGFRSARCNAPIREGKWYMEVKVEIGGGEKAPDCQLREGSHIRLGWGRREAPLN
APAGLDGYSYAYRDMTGEKVHLSRLRPYGKSFKSGDVIGMYISLPLPRRQPDRKDPYDPA
RIKRERIAIEFKGQEYFESLEYPQSKEMIALMDARDRAKATNSSSMPSSATKKAATVKNL
PSASRRKSTVQEPAPLRPLPTLGPDSHIAFFVNGECQGVAFRDLFDYLPLRNPQNKQQEK
KRSNKEGLREHKENSFDDGTLGYYPFISLFNGARVRINPGPDFEFTPPPDIDAVLSSSDA
HDADVKPHEAMRTWRPMCERYPEFMAEQWTMDEVEFAEA
Download sequence
Identical sequences B8PBL2
jgi|Pospl1|18808|gw1.71.1.1 104341.JGI18808 XP_002473061.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]