SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002473353.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002473353.1.31404
Domain Number 1 Region: 476-516
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000132
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 2 Region: 352-405
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000174
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Weak hits

Sequence:  XP_002473353.1.31404
Domain Number - Region: 93-139
Classification Level Classification E-value
Superfamily DHH phosphoesterases 0.0262
Family Exonuclease RecJ 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002473353.1.31404
Sequence length 542
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MNCARIIFELERTGSKNAEFILHLDVDEIHKVPIFRKTLKMITSDFAQSGIEQFKNVLGR
LQDVATKGRSAACAIITRPPEIIACFMIPTEGNGIFVIFDSHPRPNKHPHGAAFILNNSL
SATASYIADLLKYDDRLLSDSTLQWQAQLLAHFSAHIFTSSPTSGSAAELTEATLQASLE
VLSLRARVLDIESQNGYLTADNERLSGEVSRLEDEVAELKAQSQTQIFVQDKSYRNVSRT
FDVARDSQSQKGKGREVYVPHTSTNEVDSKQFIPPRRQIEGSHASSSRRAGSAFYDPMYD
HDFALAAALQAEQMPSQDGAYAASMQREFDGEDARLKAQMTTLKHTAPGIFECGICLEEF
NVDVVARIDICGHQFCRTCILGHTAAKIDERRYPIVCPICMADKGLKKQGDKQYEVFVEM
QLAAFSVILHCRKCKNTVFVDKSEHAATEILKIEFGGPKHSCDGSSELKHLMQQRGWKYC
PGCKTPAEKIDGCNHMTCMSPGCNTHFCYVCGEAITQSALRSEIKSALSAHYRRCRLFED
VA
Download sequence
Identical sequences B8PCF9
104341.JGI102843 XP_002473353.1.31404 jgi|Pospl1|102843|fgenesh3_pg.79__47

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]