SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002474002.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002474002.1.31404
Domain Number - Region: 84-117
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000262
Family FHA domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002474002.1.31404
Sequence length 669
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MTRAPCYERRANAIWAMPAVARVVSTVDDCRVNNQRNTTRNDRLGRIRASSGQPADSELS
VAHPPWMHHARARGSTLADPPVPQLFIKDVKSSNGTFINGERPRPEGAESEPFELKSWCE
FGIDIVGEDNKTIIHHKIAARVAQAGPTAYGVGALPAAGKFSFAPVQLPNAPGQQRRPSF
QQGLIGLGDRGRNMNVPGKSGLTLDHILSRLQGELQKSRNTGAELHSLTSAMNEIHDTLG
GNLLPNLPPHPSNLPPVMPPQSQQQQEESEQQQAPQAPSPSDSDKIRSLETMLAEHEAIK
REVGSLRELMEECKREMDTSRGRSGSPSGRRQYGHDDDSHYMSDDDDNVHSVSTIVPHEL
DRVDEEDEEQLATEEKRSSGGGGGKSWVARACQSQRERVQVQTEATEQLAEAMCSEQPPD
SAAQEAEQRTRESLTEMVNEWKKNEEWTEEREDLRRAKDEWETRIRVVEDGVGSNISKVE
SMLGTLAALPAQQHSFLNGNGKLTHSGGLVTPPSPRSLSAESTRPRQRRKRSSSSRGRSR
SRSASMAAGVECLPWTADDSSISDTESHAASDRATAAGEDEPTRSLKGMPFPITPEFSVL
NHPLSSSDDASGTATDSQTQPPPKDLSHFNLSAAFRYLFVWIPLHRFRTAELLVMPFLCQ
MGSIGPVPF
Download sequence
Identical sequences B8PE80
jgi|Pospl1|92910|fgenesh3_pg.99__6 XP_002474002.1.31404 104341.JGI92910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]