SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002475348.1.31404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002475348.1.31404
Domain Number 1 Region: 11-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2e-24
Family PARP-type zinc finger 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002475348.1.31404
Sequence length 371
Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence
MSDQEGDKKSGYRLEYAASNRSVCKGPKPCNGTKITKGELRLGSVVDFRGNTTMVWRHWG
CTTPRIIQNMKKSFEEADELDGFEDLKDEDQDKIRKAWEEEKVADEDIPETARKPEGEEG
EEEEDDKPKKKKAAGKAAKKEDADEGDKKGVFKLEYASSGRAKCKAGWGELKEGEQDKVR
RAWEEGAVPEEDQGAGEAVDTGKKAPARRRKKAEDADDAEPKKRGRKPKKVEDEDEDAEE
EKPKRKRAPAKAKNGAGEKSKAAPKKRASRKKKSSDEEDEASAEDFEDELAAVGDDFEDD
ELEEEEAPPKKRQVRADEVGRAMVLTNVQRAPTSKASAKASKPPSKKASKPVSRKKKQQE
EIPEESEVEED
Download sequence
Identical sequences B8PI33
XP_002475348.1.31404 104341.JGI88165 jgi|Pospl1|88165|fgenesh3_pm.148__5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]