SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002485480.1.73587 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002485480.1.73587
Domain Number - Region: 108-187
Classification Level Classification E-value
Superfamily Cytochrome P450 0.012
Family Cytochrome P450 0.012
Further Details:      
 
Domain Number - Region: 275-305
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0314
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002485480.1.73587
Sequence length 538
Comment pentatricopeptide repeat protein [Talaromyces stipitatus ATCC 10500]; AA=GCF_000003125.1; RF=representative genome; TAX=441959; STAX=28564; NAME=Talaromyces stipitatus ATCC 10500; strain=ATCC 10500; AL=Scaffold; RT=Major
Sequence
MRLLPLTVDGLWYCLCPSFRPTYLHRSFRSSNTVRKISRRCLSSASTTASTRAPLGERHK
QGNRSFSQYESSRLTRAPLREDEDLQSQSIGDLEALLEQSSSRRRIDISKTVAILKTLLQ
KHRVNPTTRHYKAYLLANVDRQHGSAENVRSLLGEMARQGITADSATLHAALEVLAVHPD
YLLRQEVIEALRARWLSLSPVGWHHVIAGLLREDQLELALDRLDQMEGKGIPLEQWLHSL
LVYKLCDADEFTEALRLIRSRSNKAKSISSAMWLYLLRAAIRNSHYETVRYVWNNAVDLG
YQDLSVPDCRDVLGFASDHGDIGFAESVFRHLSTLQKHPTSYDYEKLVQVYAQNADVKSA
FEIICQMHKSRIPIESECTRPVLQSMETKLSDPTILWSEIRGLRKRGYEIPTTLANIVIQ
HTEVLFQRGSLSASRAIDLAVYIYKDLFDICTDGANTETFNSLISLCHQTSKPGICTFFV
KEMASLDVSPDQRTLETLILSCLDCGNDSSASKYLADLQAQGWQLSDLVKDRIREIQN
Download sequence
Identical sequences B8MLJ4
XP_002485480.1.73587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]