SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002494298.1.19831 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002494298.1.19831
Domain Number - Region: 199-276
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0262
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002494298.1.19831
Sequence length 374
Comment Hypothetical protein PAS_chr4_0851 [Komagataella phaffii GS115]; AA=GCF_000027005.1; RF=representative genome; TAX=644223; STAX=460519; NAME=Komagataella phaffii GS115; AL=Chromosome; RT=Major
Sequence
MTTVSFQKIMVFPRIAIQDILNYDTPNCIVPMSGSSSASNSIDTGTESVSTEGEPGGSPD
GMEGEKESNTDPEGAEQLDPSSQYRYSFEVSLPYFSKLVLARKCHQLSKHTANTKFSNKI
SSQNGKRGRPYSLLINARLMVYSDLQSILSSLHKSLYDIHEYDMRNIPAVCKSPSSPAPT
EQDQLLESISRLLGCSSSLFDSHVVANTNFRALKYDCKNNSMSFLQYMDKIVQSEKYKFV
KTIRDYNGKLVKLEIIDKPNFHSNLKNMEWLKEHACFPRYKANMKIHVMLHEDTQDSNSC
ASDDSEILFYNEPRLFLHDLIYNNYGISKEDVPDLLRGSVSHLRLRLGYWADKRVLINRE
NFTEHLSSFLHHDY
Download sequence
Identical sequences C4R944 F2QXZ9
XP_002494298.1.19831 gi|254574378|ref|XP_002494298.1| 644223.PAS_chr4_0851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]