SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002590963.1.56174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002590963.1.56174
Domain Number 1 Region: 71-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000019
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 2 Region: 109-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000028
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 3 Region: 32-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000146
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 1-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000443
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002590963.1.56174
Sequence length 143
Comment hypothetical protein BRAFLDRAFT_174466, partial [Branchiostoma floridae]; AA=GCF_000003815.1; RF=representative genome; TAX=7739; STAX=7739; NAME=Branchiostoma floridae; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
PCWLGGTCLDHVDGYSCVCLTDATGKNCETALKPCDQNVCQNGGVCTSCFNESSKFCECP
AGFDGKLCEININECASSPCQNGGSCQDGINSYSCSCRTGFHGDHCESDIDECASGPCQN
GGSCQDDVNSYSCSCPTGFEGDH
Download sequence
Identical sequences C3ZK75
XP_002590963.1.56174 7739.JGI174466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]