SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002592554.1.56174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002592554.1.56174
Domain Number 1 Region: 15-257
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.06e-82
Family Calponin-homology domain, CH-domain 0.0000578
Further Details:      
 
Domain Number 2 Region: 1600-1718
Classification Level Classification E-value
Superfamily E set domains 1.47e-36
Family Filamin repeat (rod domain) 0.0000372
Further Details:      
 
Domain Number 3 Region: 1410-1526
Classification Level Classification E-value
Superfamily E set domains 1.93e-35
Family Filamin repeat (rod domain) 0.000029
Further Details:      
 
Domain Number 4 Region: 1123-1237
Classification Level Classification E-value
Superfamily E set domains 1.2e-34
Family Filamin repeat (rod domain) 0.0000251
Further Details:      
 
Domain Number 5 Region: 1313-1431
Classification Level Classification E-value
Superfamily E set domains 9.34e-30
Family Filamin repeat (rod domain) 0.000069
Further Details:      
 
Domain Number 6 Region: 938-1050
Classification Level Classification E-value
Superfamily E set domains 1.23e-29
Family Filamin repeat (rod domain) 0.00037
Further Details:      
 
Domain Number 7 Region: 2950-3044
Classification Level Classification E-value
Superfamily E set domains 1.6e-28
Family Filamin repeat (rod domain) 0.0000355
Further Details:      
 
Domain Number 8 Region: 2769-2863
Classification Level Classification E-value
Superfamily E set domains 9.34e-28
Family Filamin repeat (rod domain) 0.0000219
Further Details:      
 
Domain Number 9 Region: 3145-3238
Classification Level Classification E-value
Superfamily E set domains 1.33e-27
Family Filamin repeat (rod domain) 0.0000248
Further Details:      
 
Domain Number 10 Region: 1514-1621
Classification Level Classification E-value
Superfamily E set domains 1.8e-27
Family Filamin repeat (rod domain) 0.00017
Further Details:      
 
Domain Number 11 Region: 1227-1335
Classification Level Classification E-value
Superfamily E set domains 2.8e-27
Family Filamin repeat (rod domain) 0.00018
Further Details:      
 
Domain Number 12 Region: 713-820
Classification Level Classification E-value
Superfamily E set domains 3.69e-26
Family Filamin repeat (rod domain) 0.00049
Further Details:      
 
Domain Number 13 Region: 606-707
Classification Level Classification E-value
Superfamily E set domains 4.71e-25
Family Filamin repeat (rod domain) 0.0000948
Further Details:      
 
Domain Number 14 Region: 3471-3562
Classification Level Classification E-value
Superfamily E set domains 1.07e-24
Family Filamin repeat (rod domain) 0.0000169
Further Details:      
 
Domain Number 15 Region: 3338-3429
Classification Level Classification E-value
Superfamily E set domains 4.67e-24
Family Filamin repeat (rod domain) 0.0000363
Further Details:      
 
Domain Number 16 Region: 364-477
Classification Level Classification E-value
Superfamily E set domains 5.94e-24
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 17 Region: 798-852,895-947
Classification Level Classification E-value
Superfamily E set domains 7.01e-24
Family Filamin repeat (rod domain) 0.0023
Further Details:      
 
Domain Number 18 Region: 266-362
Classification Level Classification E-value
Superfamily E set domains 1e-23
Family Filamin repeat (rod domain) 0.00091
Further Details:      
 
Domain Number 19 Region: 3237-3332
Classification Level Classification E-value
Superfamily E set domains 2.6e-23
Family Filamin repeat (rod domain) 0.0000983
Further Details:      
 
Domain Number 20 Region: 1740-1826
Classification Level Classification E-value
Superfamily E set domains 2.27e-22
Family Filamin repeat (rod domain) 0.00023
Further Details:      
 
Domain Number 21 Region: 2851-2948
Classification Level Classification E-value
Superfamily E set domains 4.87e-22
Family Filamin repeat (rod domain) 0.0000329
Further Details:      
 
Domain Number 22 Region: 3064-3159
Classification Level Classification E-value
Superfamily E set domains 4.34e-21
Family Filamin repeat (rod domain) 0.000043
Further Details:      
 
Domain Number 23 Region: 2707-2784
Classification Level Classification E-value
Superfamily E set domains 5.6e-17
Family Filamin repeat (rod domain) 0.00033
Further Details:      
 
Domain Number 24 Region: 1037-1143
Classification Level Classification E-value
Superfamily E set domains 8.41e-17
Family Filamin repeat (rod domain) 0.0055
Further Details:      
 
Domain Number 25 Region: 564-614
Classification Level Classification E-value
Superfamily E set domains 0.000000000000182
Family Filamin repeat (rod domain) 0.0035
Further Details:      
 
Weak hits

Sequence:  XP_002592554.1.56174
Domain Number - Region: 1906-2015
Classification Level Classification E-value
Superfamily Tropomyosin 0.00108
Family Tropomyosin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002592554.1.56174
Sequence length 3563
Comment hypothetical protein BRAFLDRAFT_118903 [Branchiostoma floridae]; AA=GCF_000003815.1; RF=representative genome; TAX=7739; STAX=7739; NAME=Branchiostoma floridae; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MHTNERNPADGPEEEDMPATERDLAEDAPWKRIQKNTFTRWCNEHLKKANKNINDLETDL
SDGLRLIALIEVLSHKRIPRYNKRPTFRAMKLENVSAALQFLEDEHIKIVNIDSSDIVNG
KLKLILGLIWTLILHYSISMPMWEGDDEPAVKQTPKEKLLGFVQAKVPDLPVKNFNKDWN
DGKACGALVDACAPGLCPDWEDWNPNDKVKNCEEAMDLADKWLGVPKLLSPEDMASPHVD
DLSVMTYVSQFPQAKLKPGAPLRPKTNPNKVRVFGKGVEATGNQVGSPAPFTIDTFSAGG
GDIKVSVENPRGKQEQFKLEENLNKAKTYTCTYTPTMEGTYVVKVIFAGKEVPKSPFKVG
VAASKSDPSKCSAKGPGLESAGVVANKATYFDIFTAGSVRSPLFPPLEKGPGAGPGAVNV
VIADPDGKTNTVPVEMEQTGDGQFRCTYKPLKMGIHTITVTFDGSNIPKSPFKVNVAMPK
EDPASTTGTLIDFGDDSPTKGSTQKKETPPAFSSPGLLDDGGSLDTKSPSDPLSNQQALK
PDSSQDLLGFDSEEEDEDGCSFKGGMEMPVKVSDQGDGNYACQYRPGKPGVYKVNITFSG
QHIPKSPFTVNVGSEAKPSRIRAYGPGLEGGQVGHPAEFVVETAGEDISGLGFSIEGPSQ
AKIECHDNGDGSCDVVYWPTEAGEYAVHIVTDDEDIANSPYMAQIRPQDKKFTPGQVKAY
GPGLEKTGIVVGRTMEFTVDAKKVPAGQLQIWAYDQEAEKMDVKVRDNGNKTYTCTYTPT
KAIRYTIDISWDQVNIPNSPFRVHVAEGSYPNKVRVYGPGVEKTGLKSGKPTQFTVDCTE
AGSAGKVNRKTLTAFELYKEHFWELVHGKANTELDKAAVAGDVSIGIKCSPGVVGEREAD
IDFDIVKNDNDTFTVSYVPPAAGRYTIMVMFGEQEIPKSPFTIQVESAGDASKVKAEGPG
LEPTGVVSGKPTYFTVNTRGAGEGKLDLDFVGPSRGGGAKDVNIVDNKDETFTVHYTPVA
AGPMNVSVNYAGKPIPKSPFKVNVAPPVDLSKVKVDGLGEKVIVNQEKEFVVHTRGAGGL
GVVEITIVSVTTKKVLKTTRVEKRGDDYICVFTALEVGMYAVNVSYDGLVVDGSPFGFEA
VPGANPGKVKAYGPGLKGGKVNREQTFTIDTREAGQGGLGLTIEGPSESRIECKDRGDGT
CSVSYWPEDVGEYSINVMFADQHIPGSPFPARVVPAHDASKVKAKGPGLSPGNKAGDPCE
FTVDIREAGEAELTIEVITETGERVDVKIEETHEGTFRIKYVPQIAGSYTITIKYGGDPI
PQVPIRITIEQKVDVSGIRCYGPGVEGMFVDAPTEFTIDAKSVSRRGGDNVRCVVQNPSG
AKTEAAVKDNRDGTYTASYTPFEEGRHLIDVLYEELQVPGAPFKVQATEGCDPSKVRAYG
PGLEGGLTDKPQQFTIETKGAGTGGLGLAIEGPSEAKMTCKDNKDGSCTVEYFPTTPGDY
DIHISYGEQPIRGSPFSVLIKDDIDVSKVKAYGPGLEKTGVRAQNMQVFTVDHTKTGSAP
LDVKVTSQMGATVNTEVTDNRDGTHTVKYIPPSEGACKVDVKYDNQSIPQSPFNVRVEPP
YDASKVKATGPGLQQGVPASFPISFTIDCRDAGNADLEVILEDPDGRMKSPEIHDNGDGT
YTITYTPEQSGNYTIEIKYGGEQVPRSPFRITVKPTGDANKCSVTVRISPPGRVGQGQWI
GDGMQPYIQIGEETCVTVNCKTAGKGKVNCTIQDANGEDVDVDVVENDDGTFDIFYTAQQ
QGEYTITIRFGGQHIQGSPYKVQAVDDLAKIPNGTFQQQYMLSEAESQLQTTNERLSSLQ
KEHDDLLDQNSKLHRLYHDKLTEVEQLNSDLVEVRGMAEINSAKLQSNISILNEEVEALK
SKHKIQEGQLRDRESEIEELRRRIRELEAENEALRKKIADLRRELDDQTANMERYQREAR
DANSEVERLEQLLAQRESDIRGLQSDLLSARDEVNITKMKTTEITRAESEQLSSQMKLSN
DLQMALNEKQGRLGAMEAEARKLRSDLEISRRDNEEKFAEINGLKNKTRDMESELSGLNQ
KLYQDKQANRSLQEKLDDLQFEMNRLRRELQEKEGYITSMETKMSNLESSVVGQSSEKDG
KIQEQMEEIRRLRMKIESLNDDMTERERKMLDLAREKEELQGQYEFYFSETSKLQTQVTE
IQTVQTQMGGSTEALEDELESLRRRLKSDNEHANQEAFELHRRITELELERNTATEKLKH
MEVNMSQGSGEVEKLRQQLRRAEQDSSNTELRYNEMHKVNERLRSDMDDILHQRDIAQRL
SKEQEAKLLSLSQRLRHLEEQTRTEILDLQSKLRNLQNEYQLLDRKQQDTLDKLRVAESE
LQTERTARQSGEFSQTTVSKTTVTKTSAAEEMDSKLRGGQPDDDHDGPDGMERVGEEKLG
RKPKGHGKPRRSGSHTSSSSSSSSSSDSEDEGKSSKKKHPKKKDGEKDKDHPKKKKGVNS
DEEEPKKKGVDFGALLADAKYRPDKVERITAVPGDEMMSVPNEAISRPDDENSRPRWQDD
AKAAPGDEPFFASPAEAARQPWGKQGVVPAEEMQSRPDELRARPWRKGVPEDVTMSGPDD
TSAQPRKKWGTPGNPDDDDDIRPYKRGPDKATPGAQEEMMMADEMEAGAPGRMRPVEFVV
PIFIEVLSSGNLTAEVKQPSGRIAQPKFIDNRDGSLTIKYTPTEAGLHELGIKYNGEHIP
GSPIQFHVDEIRPGQVSAFGSGLSHGVAGQQSNFTIVTKDAGAGGLALAVEGPSKAEITC
RDNKDGTCSVSYLPTQPGEYNIIVKFADRHIPGSPFKAKIVGDQRKPQQVAVGAANEVSL
KIAEQDLSLLQASIRSPSGHEEPCLLKRLSNGHIGISFTPREVGEHLVSVKKNGRHVANS
PFKILVGQQEIGDARKVKVKGTGLRESATFDVAEFTVDTREAGYGGLGLSIEGPSKADIN
CRDNEDGTCTVTYRPTEPGNYIINIKFADQHVPGSPFTVKVTGEGAGKHTEKITRKRQAA
SVATVGSTCDLNLKIPETSPFDLSAQVTSPSGRTEDAEIVELENCTYSVRFVPAEMGIHT
VSVRYKGQHVPGSPFQFTVGPLTEGGAGKVQAGGPGLERGEVGQLSEFTIWTREAGAGGL
AIAVEGPAKAEINFEDRKDGSCGVSYMPTDPGEYQVSIKFNDDHIPGSPFSVDVTPPMGD
ARQVSVSSLQETGLKLNQPASFAVQLNGARPGDLQAQVIAPSGAQEECIITDVEEAGQYV
VRFMPRENGVYTVHVTYNGVPIPGSPFRIRAGSTLVEGDAGMVHAYGAGLEGGRTGERCE
FIVNTINAGAGALAITVDGPSKVQLDCVECDEGYKVTYIPRAPGDYNISVKYAGQNPIVG
SPFRARITGPKMAGAVSGVHESCSVVVETVSKSSAQASYAGGVQGVSRLLSDATKVKSQG
MGLKKGFLGQKNSFNVDCGNAGTNMLMVGVHGPRTPCEEVNVKHMGGQKYNVVYTVREKG
DYELIVKWGDQHIPGSPFKVTVT
Download sequence
Identical sequences C3ZFS7
XP_002592554.1.56174 7739.JGI118903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]