SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002600378.1.56174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002600378.1.56174
Domain Number 1 Region: 77-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000249
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 2 Region: 39-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000285
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 1-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000291
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 115-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000822
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002600378.1.56174
Sequence length 150
Comment hypothetical protein BRAFLDRAFT_170475, partial [Branchiostoma floridae]; AA=GCF_000003815.1; RF=representative genome; TAX=7739; STAX=7739; NAME=Branchiostoma floridae; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
DIDECLSSPCRNNATCTNLENSYSCACVPGFTGNDCDEEINECQSDPCQNGGYCSDDVNS
YNCSCLRGWAGEICEIDIDECAISPCQHGGTCEDHVNGYTCHCADGWDGEDCEINIDDCT
GVTCQHGGRCDDHVSGYSCNCTGGWIGQHC
Download sequence
Identical sequences C3YUB3
7739.JGI170475 XP_002600378.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]