SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002666454.2.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002666454.2.45394
Domain Number 1 Region: 393-515
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.15e-45
Family MBT repeat 0.0000167
Further Details:      
 
Domain Number 2 Region: 285-389
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.05e-38
Family MBT repeat 0.00000669
Further Details:      
 
Domain Number 3 Region: 500-624
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.03e-33
Family MBT repeat 0.0000414
Further Details:      
 
Domain Number 4 Region: 615-652
Classification Level Classification E-value
Superfamily CCHHC domain 0.000000000000209
Family CCHHC domain 0.00088
Further Details:      
 
Domain Number 5 Region: 741-808
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000425
Family SAM (sterile alpha motif) domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002666454.2.45394
Sequence length 815
Comment lethal(3)malignant brain tumor-like protein 1 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MSAKVDLDVLPHNADGPSESSVSHAPIDSSAHRLKPQDTTTIIFPASAHPLPKVELPQNA
IKAIKGSELEATSLPAQVGGTIVHVLGWKEGMAILPGSNLKLCVSDTGALEVISEGKIGP
TNLPTEGAQMKPANMEFKQAEKSDVSAGGNGRPAAFLEADRLHRARIEVQDSPVHSRCGQ
NMHMTELRGEPMSEIPAGLAEAQVMYREHDMMKPMKKRKRREYNSPSEDDSDAEPMDEKS
EALKIDGRQIKTGSAETKLEPWSWPQYLELQKAIAAPVRLFQETQRVPLIRNSFRQGMKL
EGIDPQHPSMYFVLTVAEVCGYRLRLHFDGYSDCHDFWVNANCADIHPAGWCESTAHKLH
TPKGCKEEEFSWSNYLKITRSQAAPKELFISSVKPETDCGFEVGMKLEAVDRMNPSLICV
ATVTDRVADRFLVHFDNWDDTYDYWCDSSSPYIHPIGWCHERGLPLTPPQDYPEVDRFSW
ERYLEETGSTAVAAEAFRVRPAHSFQVQMKLEAVDKRCPGLIRVATVQEVDTYRIKIHFD
GWSHLYDEWMDSDHPDIHPAGWCESTGHPLKPPPCQPTVPKPGPRESLAVRQPSFSMSCK
SLPQPRNTSKYSFHHRKCPTPGCDGSGHVTGRFTAHHCLSGCPLAERNQGRLKADLSDTE
GSRRNLLVFGQRAKKSRYHGRIGRPPKYRKSQQRNCQSMTSEGMYSSLFMTAFTANSERT
LSLCWEQHCKLLPGVAGIHAGQVATWTIEEVFGFVNNLIGCEEQARIFKDEMIDGESFLL
LTQNDIVKIMNIKLGPALKIHNAILMFKSTDEGLK
Download sequence
Identical sequences E7F4K3
ENSDARP00000013376 XP_002666454.2.45394 ENSDARP00000013376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]