SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002685893.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002685893.1.76553
Domain Number 1 Region: 24-168
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-31
Family Dual specificity phosphatase-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002685893.1.76553
Sequence length 345
Comment PREDICTED: dual specificity protein phosphatase 12 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MLEAQEGSHGWEHQIGSQSRASSARHMLEVRPGLFLGGAAAVAEPDHLREAAVTAVLTVD
SEEPNFKTGAGVEGLRSLFVPALDKPETDLLSHLDRCVAFIVQARAEGRAVLVHCHSGVS
RSVTVITAFMMKTDQLTFEEAYENLKTVKPEAKMNEGFEWQLKLYQAMGCEVDTSSAVYK
QYRLQKVTEKYPELQNLPQELFAVDPSAISQGLKDGGLYKCRKCRRSLFRSSSVLDHNEG
SGPIAFAHKRMTASPMLSAGSQAQCTSYFIEPVQWMESTLLGVMDGQLLCPKCNAKLGSF
NWYGEQCSCGRWIAPAFQIHKSRVDETKTLPMWGSQTRETGTRYM
Download sequence
Identical sequences F1MW70
ENSBTAP00000028997 ENSBTAP00000028997 9913.ENSBTAP00000028997 XP_002685893.1.76553 XP_581568.3.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]