SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002686423.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002686423.1.76553
Domain Number 1 Region: 67-374
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.76e-83
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 362-471
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.34e-16
Family Anticodon-binding domain of Class II aaRS 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002686423.1.76553
Sequence length 475
Comment PREDICTED: probable proline--tRNA ligase, mitochondrial [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MEGLLTRCRALPALATCSHQLSQYAPQRFHHCAPGRGKRLMLSRMFQPQKLREDQVLSLE
GRSGDLTCKSQRLMLQMGLIHPASPGCYHLLPYTVRAMEKLVRVIDQEMQTIGGQKVNMP
SLSPAELWRATKRWDSMGRELLRLRDRHGKDYCLGPTHEEAITALVASQKTLSYKQLPFL
LYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAAQLTYSLVCDAYSSLFNRLGLR
CIKVQADVGSIGGMVSHEFQLPVDVGEDRLVVCPSCHFSANMETLDSSRTNCPACQGPLT
ETKGIEVGHTFYLGTKYSSIFNAQFINVHGKPSLAEMGCYGLGVTRILAAAIEVLSTEDC
VRWPGLLAPYQVCLIPPKKGSKEEAAAELAGDLYNHITEAVPQLQGEVLLDDRTHLTIGN
RLKDANKLGYPFVIIAAKRALDDPAHFEVWCQNTGEVVFLTREGVLELLSQVQVV
Download sequence
Identical sequences F1MHD4
ENSBTAP00000050033 XP_002686423.1.76553 XP_585755.2.59421 ENSBTAP00000050033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]